PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P12180_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 523aa    MW: 58485.9 Da    PI: 7.4349
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P12180_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.94.2e-093293671854
                            HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            lFe   ++yps  ++  LA+++gLt +qV++WF N R +
  GSMUA_Achr4P12180_001 329 LFEHflHPYPSDVDKIILARQTGLTRSQVSNWFINARVR 367
                            5665569******************************88 PP

2BELL91.58.4e-30195263472
                   BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            el++ k kLls+leeV +rY++y eq++ v+ssFe +ag gsa++Y +lA+ a+S+hF+ Lkd ia+qi
  GSMUA_Achr4P12180_001 195 ELHNLKIKLLSMLEEVGRRYRKYGEQMEGVVSSFESIAGEGSATVYLTLASTAMSKHFKRLKDGIAGQI 263
                            78899***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.5E-34129261IPR006563POX domain
PfamPF075262.0E-38137260IPR006563POX domain
PROSITE profilePS5007111.839308371IPR001356Homeobox domain
SMARTSM003891.1E-9311375IPR001356Homeobox domain
CDDcd000863.75E-12311372No hitNo description
SuperFamilySSF466897.7E-18312378IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28314377IPR009057Homeodomain-like
PfamPF059201.0E-17328367IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MAHESQYSQF LLGINPLTQS LEHNHDLLGM LEISSRQQTS HFTGDFVHRD LPEPSSRRFL  60
VPAAEMATAA SAWPVADGKL CLPLFNVKPS DAFGVLESLQ HSVSGDSLQL RAAEQQQLMQ  120
EREGLAAPPP PPFYSHNSKY VKPAQELLGE LCSLGGEWNS QERSEKASHK KKREPSSSSS  180
SSSWQQSLCA MNHLELHNLK IKLLSMLEEV GRRYRKYGEQ MEGVVSSFES IAGEGSATVY  240
LTLASTAMSK HFKRLKDGIA GQINAVRRAM GEKDPSAPAM TRGETPRLKL LDQCMRQQKA  300
LQQGMAQQLP WRPQRGLPEH SVSILRAWLF EHFLHPYPSD VDKIILARQT GLTRSQVSNW  360
FINARVRIWK PMVEDMYAEE TMELDGHSNS PTTGHQHSNN QNPKPNSTLE RKPLPTLLRQ  420
SQQQHQHHQQ ITGAENFSVV DFDFSSGSYA SDNLRSSVSL TLGLQQQSKG GMSSTFSAAS  480
QQPLLFARQH AGHGQYVGFS MVDGEEDQPL PYRNLMGIQM LHD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A5e-16317374562Homeobox protein Meis2
3k2a_B5e-16317374562Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009396189.10.0PREDICTED: homeobox protein BEL1 homolog
TrEMBLM0SN830.0M0SN83_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P12180_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63983547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.12e-84TALE family protein